PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G073700.2
Common NamePHAVU_003G073700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family VOZ
Protein Properties Length: 478aa    MW: 53098.5 Da    PI: 6.0319
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G073700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ442.16.9e-1362014171217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         pppsaflgpkc+lwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkd+llfaalsa++qgk+vgipecegaatakspwn
  Phvul.003G073700.2 201 PPPSAFLGPKCSLWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMSPVLRPGGIGLKDSLLFAALSARAQGKDVGIPECEGAATAKSPWN 291
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfdl++legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei+++da+al
  Phvul.003G073700.2 292 APELFDLTVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEISKCDACAL 382
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgkvskdsladlqkklgrlta 217
                         yrlelklvd+kk++k+k+++ds+adlqk++grl+a
  Phvul.003G073700.2 383 YRLELKLVDGKKNSKTKLANDSVADLQKQMGRLSA 417
                         *********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MKKVPKNSCK SASHRLFKDK AKNRVDDLQV MFLDLQYARK ESRTVDAAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDICRL LQLCDEEDDA SSPLAAPKSE PNDQTLQAGG  120
KVMFQEGQQQ HDFPLIDECK NSTSSVQNVA ANNPDGHALE YHQFDLHQDY DHGFYTGFNG  180
TGYCEEDAIP HISSYLPSIC PPPSAFLGPK CSLWDCPRPA QGLDWCQDYC SSFHAALALN  240
EGPPGMSPVL RPGGIGLKDS LLFAALSARA QGKDVGIPEC EGAATAKSPW NAPELFDLTV  300
LEGETIREWL FFDKPRRAFE SGNRKQRSLP DYSGRGWHES RKQVMNEFGG LKRSYYMDPQ  360
PLNHFEWHLY EYEISKCDAC ALYRLELKLV DGKKNSKTKL ANDSVADLQK QMGRLSAEFP  420
HDNKRAAKGR AKVNAKVGIG GVYSASHRVT TLNGAYEYGL AAPYDYLVEN MGDYYGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153892.10.0hypothetical protein PHAVU_003G073700g
RefseqXP_007153893.10.0hypothetical protein PHAVU_003G073700g
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLV7C6U10.0V7C6U1_PHAVU; Uncharacterized protein
STRINGGLYMA07G32374.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein